Twilight Sequence (@twilightseq) Twitter Followers • TwiCopy

Gareth (HDRF)

@horrordwarf

side two, track two

+ Follow

Bob Fischer

@bob_fischer

Writer and that. Does @hauntedgen, co-founder of @mulgraveaudio. Also Wiffle Lever To Full!, Fortean Times, Electronic Sound, Doctor Who Magazine, Summer Winos

+ Follow

Coney Island Sound

@cny_islnd_snd

Coastal Dwelling Music Maker. North Coast via Belfast, Hull, Gateshead & North Shields.

+ Follow

Norman Records

@normanrecords

UK vinyl specialists. The best music, the best service, the best prices.

+ Follow

The Home Current

@thehomecurrent

See it, play it, sorted.

+ Follow

The Twelve Hour Foundation

@12hrfoundation

Polly Hulse / Jez Butler ... radiophonic / analogue electronics / library music / hauntology... bsky.app/profile/12hrfo…

+ Follow

Dominic Brunt

@dominicbrunt

That Paddy off of Emmerdale Farm..oh you doo…the vet! Filmmaker, Archaeologist, Technical Sheet Metal Developer, Welder, Land Rover Enthusiast..really boring.

+ Follow

condorman

@condorman72

+ Follow

Polypores 🌳👽🌳

@stephenjbuckley

Cosmically a shambles. Contact: [email protected] Other links below.

+ Follow

autumna.

@avtvmna

+ Follow

Mark Walters

@markwalters_

Archaeologist @ The Trust for Welsh Archaeology - Sound & Music, Photography, Wildlife, Botany, Palaeontology, Astronomy, Art, LiDAR, Ancient History & Coinage

+ Follow

soullessparty

@soullessparty

Music/Comedy writer sort - As heard on ‘Scarred for Life’, BBC Radio 4 and 6, BBC Tees. Creator of ‘Listen Through the Brown Window’ 📻 (Apple/Spotify)

+ Follow

montizhe

@ebesorlecky

+ Follow

Jilk

@jilkmusic

Post Rock Electronic collective | Live Sound | Mastering engineer income based rates - DM for rates.

+ Follow

CLAIR 🎵🍄🌈🌿✨️

@clairhotgem

Quietus 'Clair's tracks sift delicate layers into stunning intricate sound worlds' #Sähkö #HotGem #NTS #BBC3 #BBC6 MDANT DJ Sonic book club @listen_camp

+ Follow

🇲 🇦 🇷 🇹 🇮 🇳

@martincarbrand

Music, Film, Art and Motorsport @martincarbrand.bsky.social

+ Follow

Hilary Robinson

@hvrlon

Music maker: composer, piano, melodica, vox. Collaborates electro-acoustically with Jo Johnson @werkhouse: LP 9128.live. Solo @2ndlanguagerecs & @wiaiwya

+ Follow

sm🥀

@smercatante_

▲////\\\\////\\\\////\\\\▲

+ Follow

Arthur

@arthursdug

Musicrunningdugswalkingvegancyclinggymchesspoliticsmountainsbeercarslaurelnhardysnowboardingmorerunningthe smoutgardeningmorerunningradiopresenter

+ Follow

Gareth Gardner

@gardnergareth

Photographer, journalist and curator of architecture and design. Also runs Gareth Gardner Gallery in SE8, exhibiting photography of architecture and place.

+ Follow

Kate Bosworth

@kaaaate22

Dark Train on @warminsterradio 105.5 FM. Moonday 2200. Season: FIGGY HOBBIN. Half of @BMH_13 🦹🏼‍♂️🦹🏻‍♀️🦜🦜☠️☠️ @IrregularPat1 & Dustopian Frequencies

+ Follow

advance romance

@futiqueagent

🪜📡🧲

+ Follow

Apta

@aptamusic

Chromatic cascades / Boss fight modular melodies. 'Wanton Gilmourisms'. @piccadillyrecs synth fancier.

+ Follow

murmurs from the stardust vixen ΘΔ

@ambientfoxfire

The far out fox: music & trans life blogs I'm more active at Faroutfox.bsky.social

+ Follow

paul beard

@15beardy

+ Follow

Sulk Rooms

@sulkrooms

Luminescent electronica. Yorkshire. Licensing @DominoPubCo. Playing in @pijnband. “Ephemeral, elusive and gloriously unsettling” - Electronic Sound Magazine

+ Follow

Concretism

@concretism_mus

Music of a grim, Cold War Britain. Releases on vinyl. Remixes sometimes. Soundtracks for the BBC, Rook Films and Sean Reynard. @ErrorC_rrection

+ Follow

FieldLinesCartographer

@flcartographer

“The sound of big, strange worlds” -Electronic Sound Magazine // Castles In Space / Quiet Details / Woodford Halse

+ Follow

Dino Olivieri

@olivieridino

Independent musician and producer. Crafting soundscapes, computer programs and visual wonders that defy the ordinary

+ Follow

Room of Wires

@roomofwires

Room of Wires have never met. Together they create uneasy electronic music.

+ Follow

darby Jones

@darbyjones123

NYC 📍media personality | content creator | marketing manager author | content writer @thesource

+ Follow

Kieran Mahon

@kieranmahon1

UEFA C licensed coach. Maker of football programmes & electronic music. At the same time.

+ Follow

A'BEAR

@janineabear

+ Follow

The Metamorph

@themetamorphuk

Minimalist,futurist electronica with occasional forays into pastoral textures. One half of ARDALA,with Phil Heeks themetamorph.bandcamp.com

+ Follow

DJ SpaceTerrapin

@gehegedrei

The Voice of the Zoological Garden. Archivist of Enclosure Three. It Came From Enclosure Three @madwaspradioMWR/@mixcloud. Gehege Drei Kaleidoskop: @mixcloud.

+ Follow

The British Stereo Collective/Phil Heeks

@britstereocoll

Retro electronica 1970s/1980s. The British Stereo Collective, The New Electric Frontier, The Eternal Machine, Ardala. Daylights as graphic artist.

+ Follow

Verona Lakin

@veronalaki46392

+ Follow

Kianna Blick

@kiannablic61264

+ Follow

Uhocoob

@uhocoob7586

+ Follow

Ned Schulist

@schulist30119

+ Follow

WHI Recordings

@whirecordings

Electronic music and sound. Releases by Secret Nuclear, tspear and more. Check the linktree for live dates and release info.

+ Follow

Tonewulf

@tonewulf_band

Tonewulf is an American electronic band from North Carolina. We explore reality through light and sound. Join us.

+ Follow

BOLQUIO

@bolquio

Electronic music by BOLQUIO | soundcloud.com/bolquio

+ Follow

Meeru

@meeru1414

+ Follow

Multi Music

@multimusic2k24

+ Follow

Mulgrave Audio

@mulgraveaudio

Original audio drama. Where white noise meets dark forests, where waking terrors meet sleepy hollows, where analogue dreams meet digital nightmares...

+ Follow